2025-05-10_00000082_full_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 669003 | Complete | Structure prediction | RoseTTAFold | 2025-05-10_00000082_full_... | 64 | 10 May 2025 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: SNVHFGAGCDSCGVYPIIGDRYRCKDCKEEIGYDLCKDCYETPSKVPGRFNQQHTPDHRLELAR
disopred: ----------------------------------------------------------------
tmhmm: ----------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 661382 | 1 | 1 | 0.70 | RoseTTAFold | 1-64 | 64 | 10 May 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington