2025-06-07_00000432_full_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 674004 | Complete | Structure prediction | RoseTTAFold | 2025-06-07_00000432_full_... | 67 | 7 Jun 2025 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: EFTKDIYHVTADLLNVRSESNTESKILGRLKKDDVIESTNQVKDGWLQFEYKGKTAYVNVSFLSSKA
disopred: DD----------------------------------------------------------------D
tmhmm: -------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 666517 | 1 | 1 | 0.89 | RoseTTAFold | 1-67 | 67 | 14 Jun 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington