2025-06-28_00000184_full_11
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 676567 | Error | Structure prediction | cameo | 2025-06-28_00000184_full_... | 125 | 28 Jun 2025 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 .
sequence: KKIKLNIKEFKATAEGLSPEEKELWDKFAEKLKKELNNKIINLGEKIEIEEELKTPTKSIKITFSLELVSEDTFKATLKLEIKGKETIVEEETVEFKAGETVKLTIKLPDGKTFTLELKLEATKI
disopred: DDD---------DDDDDDDDDD-----------------------------------------------------------------------------------------------------DD
tmhmm: -----------------------------------------------------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 668532 | 1 | 1 | n/a | TrRefineRosetta | 1-125 | 125 | 28 Jun 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington