Juan J
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 691014 | Expired | Structure prediction | LUIS | Juan J | 90 | 17 Oct 2025 | 1 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90
sequence: MNKSELIMKVAEDADISKAKAEAAVNALINSVTEELKAGGTVALTGFGTFLVKERAARTGRNPQTGENIQIAAANIPGFKAGKGLKDSVN
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 682139 | 1 | 1 | 0.89 | RoseTTAFold | 1-90 | 90 | 17 Oct 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington