CuffGet ORF prediction
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 691021 | Expired | Structure prediction | tjakarumendu@gmail.com | CuffGet ORF prediction | 37 | 17 Oct 2025 | 1 Dec 2025 |
1 . 10 . 20 . 30 .
sequence: VQAESALTRMLSSALWRPSLLMSPRSIKHSCHISTLA
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 682148 | 1 | 1 | 0.84 | RoseTTAFold | 1-37 | 37 | 17 Oct 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington