LSEI_2386
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 691192 | Expired | Structure prediction | nawanwatcpa | LSEI_2386 | 63 | 19 Oct 2025 | 3 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: LNSCKAKEYFNLNEEEKEMKQFDEQKMVNMSDEELLGFIGGDSIRDVSPTFNKIRRWFDGLFK
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 682353 | 1 | 1 | 0.82 | RoseTTAFold | 1-63 | 63 | 19 Oct 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington