protein 5
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 691254 | Expired | Structure prediction | laidback_tng | protein 5 | 95 | 20 Oct 2025 | 4 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 .
sequence: NCVRLWTSHCWKIVTAGKSVTSNSMMSHDINCLVLDGRVWDGLVQRNNKPENADLSWVSRLKNEGKVCEKDHCVWFMGRYKINPDYLMDYSSHPP
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 682441 | 1 | 1 | 0.53 | RoseTTAFold | 1-95 | 95 | 20 Oct 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington