GLP-1R
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 691288 | Expired | Structure prediction | kangrui Liu | GLP-1R | 42 | 20 Oct 2025 | 4 Dec 2025 |
1 . 10 . 20 . 30 . 40
sequence: HAEGTFTSDVSSYLEEQAAKEFIAWLVKGGGGGGHRPYIAHC
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 682465 | 1 | 1 | 0.70 | RoseTTAFold | 1-42 | 42 | 20 Oct 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington