prolineR
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 691595 | Complete | Structure prediction | wshang | prolineR | 93 | 23 Oct 2025 | 7 Dec 2025 (58:20:07) |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90
sequence: ATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQ
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 682748 | 1 | 1 | 0.69 | RoseTTAFold | 1-93 | 93 | 23 Oct 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington