PR187-244
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 691596 | Complete | Structure prediction | wshang | PR187-244 | 59 | 23 Oct 2025 | 7 Dec 2025 (58:20:48) |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: GEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQ
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 682749 | 1 | 1 | 0.75 | RoseTTAFold | 1-59 | 59 | 23 Oct 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington