Alpha Haptoglobin
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 691753 | Expired | Structure prediction | bioguy6022 | Alpha Haptoglobin | 83 | 25 Oct 2025 | 9 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80
sequence: VNDSGNDVTDIADDGQPPPKCIAHGYVEHSVRYQCKNYYKLRTQGDGVYTLNNEKEWINKAVGDKLPECGAVGKPKNPANPVQ
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 682875 | 1 | 1 | 0.74 | RoseTTAFold | 1-83 | 83 | 25 Oct 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington