| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 691914 | Complete | Structure prediction | 15514847056 | GP5 5 | 75 | 28 Oct 2025 | 12 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: RLAKNCMSWRYSCTRYTNFLLDTKGRLYRWRSPVIVEKGGKVEVEGHLIDLKRVVLDGSAATPLTRVSAERWGRL
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 683024 | 1 | 1 | 0.60 | RoseTTAFold | 1-75 | 75 | 28 Oct 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington