bli_from179
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 691917 | Active | Structure prediction | HEMCHANDRA | bli_from179 | 133 | 28 Oct 2025 | 12 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130
sequence: GSKGQPGRNGKDGLPGVPGLPGQPGEPGDDGEPGEDGDPGQPGDNGEPGKCDEVNVAQGPPGSPGPPGLPGPDGLPGTPGNPGQDGEQGPAGEPGRDGKDGQPGRPGQPGPPGEPGTGGGCEHCPTPRTAPGY
tmhmm: -------------------------------------------------------------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| - | 1 | 1 | n/a | ab initio | 1-133 | 133 | - |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington