Naeglaeria Fowleri
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 692223 | Complete | Structure prediction | anveshaseervi | Naeglaeria Fowleri | 119 | 31 Oct 2025 | 15 Dec 2025 (32:13:18) |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 .
sequence: MATTIPSPFNWDSSFCVGNNELNEQHKKLFALINALDANRSSASALKELLDFVVMHFKAEEDLFAKVNFSDSTSHKETHDKFVQDALGLKTVGDAEIQFIKQWLVNHIKGSDMKYKGVL
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 683306 | 1 | 1 | 0.89 | RoseTTAFold | 1-119 | 119 | 31 Oct 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington