| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 692237 | Complete | Structure prediction | Xin Zao | 3I40 | 30 | 31 Oct 2025 | 15 Dec 2025 (37:03:35) |
1 . 10 . 20 . 30
sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKA
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 683320 | 1 | 1 | 0.84 | RoseTTAFold | 1-30 | 30 | 31 Oct 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington