R85X
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 692246 | Expired | Structure prediction | mythri_04 | R85X | 85 | 31 Oct 2025 | 15 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 .
sequence: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTR
tmhmm: -------------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| - | 1 | 1 | n/a | comparative modeling | 1-85 | 85 | - |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington