| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 692280 | Complete | Structure prediction | Vrenili | A1G2_325-396 | 72 | 31 Oct 2025 | 15 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: SILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNKILQADQEL
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 683359 | 1 | 1 | 0.85 | RoseTTAFold | 1-72 | 72 | 31 Oct 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington