| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 692360 | Active | Structure prediction | RoseTTAFold | 2025-11-01_00000270_full_... | 180 | 1 Nov 2025 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180
sequence: GSHMDYLTGKWKLWYKMLDVNHDGKISIEDVEESRNKFTNLHELLEEKAKGVKVDMENWWTEYIFGQNGPKEISEADFVKRLQTAYETDKAAFVKKMENCFNTIFDVIDTNKDRQIELDEFVLVFKAFGHENEPAVTKFFGLYNAPAGIPIKDIVAYVKFTTSDNSNDTDYVNQSLKLVL
tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington