| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 692432 | Complete | Structure prediction | sivabio | HMGN3f | 82 | 3 Nov 2025 | 18 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80
sequence: MPKRKPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTAPSENGETKAEEAQKTESVDNEGE
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 683468 | 1 | 1 | 0.76 | RoseTTAFold | 1-82 | 82 | 3 Nov 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington