V30E
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 692797 | Complete | Structure prediction | Aaminah Mehmood | V30E | 66 | 5 Nov 2025 | 20 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: SEAASLSPKKEDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 683819 | 1 | 1 | 0.84 | RoseTTAFold | 1-66 | 66 | 5 Nov 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington