anopheles 90-200 in 2POH option CM
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 692931 | Active | Structure prediction | ksh130 | anopheles 90-200 in 2POH ... | 111 | 6 Nov 2025 | 21 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110
sequence: QIPVPTPDEVRAGSGPATVKMEPVAQPPAAKESPKEQPPAKAQQKQSDSKPPKEKKPKKEKPAGGEGKPAAPAVEEPPIDVGRLDMRVGRIVEVSRHPDADSLYVEKIDCG
tmhmm: ---------------------------------------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| - | 1 | 1 | 0.30 | comparative modeling | 1-111 | 111 | - |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington