1c3a-19sol-2
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 693454 | Expired | Structure prediction | gsdsdt | 1c3a-19sol-2 | 135 | 11 Nov 2025 | 26 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 .
sequence: MFTCPPGWSGYEDSCYRVFNEPHNWEDAKKLCKELYGGAHLYVLESAEVREFVAKLIKTEISSPLTYVWLGLVNPATKQRNKKVDDNGKPVTKENIEPEDRKRCGALESGTALTYLVRGNDTTKNPYVCKVEPES
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 684435 | 1 | 1 | 0.74 | RoseTTAFold | 1-135 | 135 | 11 Nov 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington