Dermacentor 229-309 in 2POH
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 693950 | Complete | Structure prediction | ksh130 | Dermacentor 229-309 in 2P... | 81 | 14 Nov 2025 | 29 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80
sequence: STPEKVEILAPPPGAQPGDRVVCDGYPGQPDAQLNPKKKIFEQVAPDLKTDSEKRATYKGKPWLVTGRQGHVTAETLCNVQ
disopred: DD-----------------------------------------------------------------------------DD
tmhmm: ---------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 684899 | 1 | 1 | n/a | comparative modeling | 1-81 | 81 | 14 Nov 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington