sar
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 694054 | Complete | Structure prediction | poo | sar | 70 | 15 Nov 2025 | 30 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: MLPPCYNFLKEQHCQKASTQREAEAAVKPLLAPHHVVAVIQEIQLLAAVGEILLLEWLAEVVKLPSRYCC
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 684997 | 1 | 1 | 0.66 | RoseTTAFold | 1-70 | 70 | 15 Nov 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington