1PGA_1_Chain_A_PROTEIN_G_Streptococcus_sp_GX7805_1325__RoseTTAFold
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 694058 | Complete | Structure prediction | georgiagoulart | 1PGA_1_Chain_A_PROTEIN_G_... | 56 | 15 Nov 2025 | 30 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 684999 | 1 | 1 | 0.92 | RoseTTAFold | 1-56 | 56 | 15 Nov 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington