Integrase
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 695293 | Complete | Structure prediction | vicky23101994 | Integrase | 58 | 27 Nov 2025 | 11 Jan 2026 (54:46:51) |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: KTAVQMAVFIHNFKRKGGIGGYTAGERIIDIIATDIQTTKLQTQILKVQNFRVYYRDS
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 686104 | 1 | 1 | 0.80 | RoseTTAFold | 1-58 | 58 | 27 Nov 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington