smim20
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 695592 | Complete | Structure prediction | khadeejagen | smim20 | 69 | 2 Dec 2025 | 16 Jan 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: MAAARNLRTGLIFGGFISMVGAAFYPIYFRPLMRLEEYQKEQAVNRAGIIQEDVQPPGLKVWSDPFGRK
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 686348 | 1 | 1 | 0.82 | RoseTTAFold | 1-69 | 69 | 2 Dec 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington