1
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 695663 | Complete | Structure prediction | lijun_1jiang@163.com | 1 | 183 | 3 Dec 2025 | 17 Jan 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180
sequence: MSRVYVGNLDPRVSERELEDEFRIFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIKELDGKNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGESGHFARECRTRGGPGAGRRRSRSPPRYRRSPSYGRRSYSPRGRSPRRRSPSPRGRSYSRSPYRGREEAPYVNGNGLRECHRSRS
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 686417 | 1 | 1 | 0.53 | RoseTTAFold | 1-183 | 183 | 3 Dec 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington