Cassiicolin cas3
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 696355 | Complete | Structure prediction | dara | Cassiicolin cas3 | 58 | 10 Dec 2025 | 24 Jan 2026 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: MKYLPILISAFVAAITAAPQDPSAVAPLLPRQSCVSCVNFGNGFCGDNCGNSWACSGC
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 687027 | 1 | 1 | 0.78 | RoseTTAFold | 1-58 | 58 | 10 Dec 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington