wfgf1vk
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 696757 | Complete | Structure prediction | vkfgf | wfgf1vk | 141 | 15 Dec 2025 | 29 Jan 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140
sequence: MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 687408 | 1 | 1 | 0.90 | RoseTTAFold | 1-141 | 141 | 15 Dec 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington