a2-rf
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 697017 | Complete | Structure prediction | dsairam789 | a2-rf | 63 | 18 Dec 2025 | 1 Feb 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: VGGNPGDCGRNSETAPRMTLLRGKRPARSCTWGRLILSGLPGVRVQNPRRKKWMRPSGCRCSK
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 687622 | 1 | 1 | 0.54 | RoseTTAFold | 1-63 | 63 | 18 Dec 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington