hypothetical protien
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 697228 | Complete | Structure prediction | eshainam | hypothetical protien | 64 | 20 Dec 2025 | 3 Feb 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: MEKTKRDEMLFHGKKHVYIPPVFEIVLVEMEAGISATSALVKPDTTVQTDWEGTDTQTGEIIWE
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 687786 | 1 | 1 | 0.71 | RoseTTAFold | 1-64 | 64 | 20 Dec 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington