BXH2_00024903
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 697243 | Complete | Structure prediction | zaizai | BXH2_00024903 | 94 | 21 Dec 2025 | 4 Feb 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90
sequence: MSNLPQPHCLAPAFGGGPAPPPLSSAAGGGQPVRDRKIASAEQLVLDLCEPDLRENALGELSKVSRSRVLFLRIAFFDLDVPRRVLEILITVDC
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 687803 | 1 | 1 | 0.59 | RoseTTAFold | 1-94 | 94 | 21 Dec 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington