BXH3_00028281
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 697260 | Complete | Structure prediction | zaizai | BXH3_00028281 | 77 | 21 Dec 2025 | 4 Feb 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: MSFFVGIVLGIAFGLGLVIAFARSETSRSKRRRELVIPFPFPCFLRSICSNFYTALLFLCFCRLVIVVMLFPSSNAT
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 687818 | 1 | 1 | 0.87 | RoseTTAFold | 1-77 | 77 | 21 Dec 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington