2M4F_chain_A_V2
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 697682 | Complete | Structure prediction | tekpinar | 2M4F_chain_A_V2 | 151 | 28 Dec 2025 | 11 Feb 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150
sequence: KIHTSYDEQSSGESKVKKIEFSKFTVKIKNKDKSGNWTDLGDLVVRKEENGIDTGLNAGGHSATFFSLEEEVVNNFVKVMTEGGSFKTSLYYGYKEEQSVINGIQNKEIITKIEKIDGTEYITFSGDKIKNSGDKVAEYAISLEELKKNLK
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 688207 | 1 | 1 | 0.81 | RoseTTAFold | 1-151 | 151 | 28 Dec 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington