1bbz_1_A
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 697771 | Error | Structure prediction | Xu Xiwen | 1bbz_1_A | 58 | 29 Dec 2025 | 12 Feb 2026 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 688280 | 1 | 1 | n/a | RoseTTAFold | 1-58 | 58 | 29 Dec 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington