P06463
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 697786 | Active | Structure prediction | SPD | P06463 | 158 | 29 Dec 2025 | 12 Feb 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 .
sequence: MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEKLRHLNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV
tmhmm: --------------------------------------------------------------------------------------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| - | 1 | 1 | n/a | ab initio | 1-158 | 158 | - |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington