Cytochrome c oxidase
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 698087 | Complete | Structure prediction | dineshm25 | Cytochrome c oxidase | 83 | 5 Jan 2026 | 19 Feb 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80
sequence: MADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCPLDWIEKWDDQREKGIFAGDINSD
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 688565 | 1 | 1 | 0.77 | RoseTTAFold | 1-83 | 83 | 5 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington