| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 698212 | Complete | Structure prediction | ammanning | GA981 | 56 | 6 Jan 2026 | 20 Feb 2026 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: TTYKLILNLKQAKEEAIKELVDAGTAEKYFKLIANAKTVEGVWTLKDEIKTFTVTE
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 688687 | 1 | 1 | 0.62 | RoseTTAFold | 1-56 | 56 | 6 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington