Structure prediction of GB98
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 698250 | Complete | Structure prediction | ejhafey | Structure prediction of G... | 56 | 6 Jan 2026 | 20 Feb 2026 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: TTYKLILNLKQAKEEAIKELVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 688732 | 1 | 1 | 0.79 | RoseTTAFold | 1-56 | 56 | 6 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington