| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 698775 | Complete | Structure prediction | Joanna | Plasmic5 | 65 | 12 Jan 2026 | 26 Feb 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: NIDPQPDFKAFKENLEAQAGPGGGGSGVQKQFKVIEKLVSDCEGGGGSKKYLFKAHDFFEEHGKV
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 689226 | 1 | 1 | 0.76 | RoseTTAFold | 1-65 | 65 | 12 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington