19-16-22
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 698920 | Active | Structure prediction | Joanna | 19-16-22 | 128 | 13 Jan 2026 | 27 Feb 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 .
sequence: GVQKQFKVIEKLVSDCEGGGGSPFEIVSFEIKEGKEKNPRLFDLTGQVGGGGSKVISLHQIPEVKEKKERAPRKSTVIEWGGGGSNIDPQPDFKAFKENLEAQAGPGGGGSKKYLFKAHDFFEEHGKV
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 689365 | 1 | 1 | n/a | RoseTTAFold | 1-128 | 128 | 13 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington