Construct 1 DENV3
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 699106 | Complete | Structure prediction | Chrisonimac | Construct 1 DENV3 | 86 | 15 Jan 2026 | 1 Mar 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 .
sequence: LKKEVSETQHGTILIKKKESQKNGSWKKKVGDITGVLEQGKRTLTGGGSNGSWKLEKASLIEVKTCTWPGPGPGAAVKDERAVAAY
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 689538 | 1 | 1 | 0.52 | RoseTTAFold | 1-86 | 86 | 15 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington