| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 699150 | Expired | Structure prediction | fhoh3467 | U2-Ct | 50 | 15 Jan 2026 | 1 Mar 2026 |
1 . 10 . 20 . 30 . 40 . 50
sequence: SCIAEYKGNYCNYETNREGLSDLYDYGDYRYQVYYSEPSCIEDNCNQFQE
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 689583 | 1 | 1 | 0.60 | RoseTTAFold | 1-50 | 50 | 15 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington