U2-Nt-2
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 699151 | Complete | Structure prediction | fhoh3467 | U2-Nt-2 | 84 | 15 Jan 2026 | 1 Mar 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80
sequence: GRRVLAYPRLPTYAPTRLVLKTRAIYDVRVDECKSCIAEYKGNYCNYETNREGLSDLYDYGDYRYQVYYSEPSCIEDNCNQFQE
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 689584 | 1 | 1 | 0.54 | RoseTTAFold | 1-84 | 84 | 15 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington