CTLA-4 complet
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 699160 | Complete | Structure prediction | mathieu.dumesnil | CTLA-4 complet | 130 | 15 Jan 2026 | 1 Mar 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130
sequence: KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDLVPR
disopred: D--------------------------------------------------------------------------------------------------------------------------DDDDDDD
tmhmm: ----------------------------------------------------------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 689592 | 1 | 1 | n/a | comparative modeling | 1-130 | 130 | 15 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington