8P6Q
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 699165 | Complete | Structure prediction | MVAB | 8P6Q | 45 | 15 Jan 2026 | 1 Mar 2026 |
1 . 10 . 20 . 30 . 40 .
sequence: SCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFN
disopred: DD---DD--------------------------------------
tmhmm: ---------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 689608 | 1 | 1 | 0.90 | comparative modeling | 1-45 | 45 | 15 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington