3NIR_20pct_22031_rep5
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 699355 | Complete | Structure prediction | thangfart | 3NIR_20pct_22031_rep5 | 46 | 18 Jan 2026 | 4 Mar 2026 |
1 . 10 . 20 . 30 . 40 .
sequence: TTCCPQIVARSIFNVCRFPGTSNAICATYTGCIMIAGADCQGDYSN
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 689765 | 1 | 1 | 0.90 | RoseTTAFold | 1-46 | 46 | 18 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington