DENV1_5
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 699521 | Complete | Structure prediction | iinquimboy | DENV1_5 | 52 | 20 Jan 2026 | 6 Mar 2026 |
1 . 10 . 20 . 30 . 40 . 50
sequence: YEGTDAPCKIPFSSQDGGGSIEAEPPFGESYGGGSTANPIVTDKEKPVNIEA
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 689922 | 1 | 1 | 0.69 | RoseTTAFold | 1-52 | 52 | 20 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington