MNPRSTVWYACHIQRST

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
699552ActiveStructure prediction Michael-MNPRSTVWYACHIQRST48020 Jan 20266 Mar 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480
   sequence: MNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPRSTVWYACHIQRSTMNPR
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
68995211n/aRoseTTAFold1-48048020 Jan 2026



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington